/eh/2025-01-08/173633966714069467/picture.png)
/eh/2024-12-24/173503345348979036/Favorite-Icon.png){kind=icon}
/eh/2025-07-08/1751962110204480194/picture.png)
/eh/2025-06-21/1750485478958537574/countryInfoIcon.png)
/eh/2025-06-21/1750485741321434291/Hi-Sign-in-My-Nihao.png)
/eh/2025-06-21/1750485837193896318/cart.png)
/eh/2025-06-21/1750485968202533847/cart.png)
/eh/2025-04-17/1744862476612819675/hot-img.png)
/eh/2025-11-07/1762504524550532584/header-icon.jpg){kind=icon}
/eh/2025-07-07/1751875582852206790/header-icon.png){kind=icon}
/eh/2025-07-07/1751875587886277738/header-icon.png){kind=icon}
Best in 7 days
download picture
description
IGF-1 LR3IGF 1 LR3 Research Grade Peptide IGF 1 LR3 is a modified analog of insulin like growth factor 1 (IGF 1) studied for its role in cellular growth, anabolic signaling, and tissue repair pathways. It is designed to have lower affinity for IGF binding proteins than native IGF 1, which may increase biological availability in research settings.[1][2] Product Details Synonyms: Long R3 IGF 1; IGF 1 LR3; Long Arg3 IGF 1 Peptide Type: IGF 1 analog Sequence:
Shopping security
product description
Why choose thelockerguy wholesale?
IGF-1 LR3 – Research Grade Peptide
IGF-1 LR3 is a modified analog of insulin-like growth factor-1 (IGF-1) studied for its role in cellular growth, anabolic signaling, and tissue repair pathways. It is designed to have lower affinity for IGF-binding proteins than native IGF-1, which may increase biological availability in research settings.[1][2]
Product Details
- Synonyms: Long R3 IGF-1; IGF-1 LR3; Long Arg3 IGF-1
- Peptide Type: IGF-1 analog
- Sequence: MFPAMPLLSLFVNARPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Molecular Weight: 9117.60 g/mol
- CAS Number: 946870-92-4
- Solubility: Soluble in water (typically provided as acetate salt); reconstitute in sterile water or dilute acetic acid
For Research Use Only. This product is supplied for scientific research and laboratory use only, not for human or veterinary administration.
IGF-1 LR3
Item no
:
59460169058
US$ 39.89
Pay in 4 interest-free payments of $9.97 Learn more
Min. order:
1piece
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 10 - Jul 15
US$40
Get nowSign up to your membership to get coupons up to
15%
Get nowOpportunity to enjoy order discount up to 15% off
Please add the products
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
Discover Niche Categories That Outsell
Top-Converting Item to Boost Your Average Order
Best in 7 days
Best in 7 days
Best in 7 days
Best in 7 days
recommand products
